Scroll Down to See All▾
abortabsacosasctimeasctime_rasinassertatanatan2atexitatofatoiatolbsearchbtowccalloccatclosecatgetscatopenceilclearerrclockcoscoshctimectime_rdifftimediverferfcexitexpfabsfclosefdopenfeofferrorfflushfgetcfgetposfgetsfgetwcfgetwsfopenfprintffputcfputwsfreadfreefreopenfrexpfscanffseekfsetposftellfwidefwprintffwritefwscanfgetcgetchargetenvgetwcgetwchargmtimegmtime_rhypotisalnumisalphaisasciiisblankiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalnumiswalphaiswblankiswcntrliswctypeiswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitisxdigitj0j1jnlabsldexpldivlocaleconvlocaltimelocaltime_rloglog10longjmpmallocmblenmbrlenmbrtowcmbsinitmbsrtowcsmbstowcsmbtowcmemchrmemcmpmemcpymemmovememsetmktimemodfnextafternextafterlnexttowardnexttowardlnl_langinfoperrorpowprintfputcputcharputenvputsputwcputwcharqsortquantexpd32quantexpd64quantexpd128quantized32quantized64quantized128samequantumd32raiserandrand_rreallocregcompregerrorregexecregfreeremoverenamerewindscanfsetbufsetjmpsetlocalesetvbufsignalsinsinhsnprintfsprintfsqrtsrandsscanfstrcasecmpstrcatstrchrstrcmpstrcollstrcpystrcspnstrerrorstrfmonstrftimestrlenstrncasecmpstrncatstrncmpstrncpystrpbrkstrptimestrrchrstrspnstrstrstrtodstrtod32strtod64strtod128strtofstrtokstrtok_rstrtolstrtoldstrtoulstrxfrmswprintfswscanfsystemtantanhtimetime64tmpfiletmpnamtoasciitolowertouppertowctranstowlowertowupperungetcungetwcva_argva_copyva_endva_startvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsprintfvsnprintfvsscanfvswprintfvswscanfvwprintfvwscanfwcrtombwcscatwcschrwcscmpwcscollwcscpywcscpywcsftimewcslenwcsncatwcsncmpwcsncpywcspbrkwcsptimewcsrchrwcsrtombswcsspnwcsstrwcstodwcstod32wcstod64wcstod128wcstofwcstokwcstolwcstoldwcstombswcstoulwcsxfrmwctobwctombwctranswctypewcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwprintfwscanfy0y1



Function Details : yn

doubleyn(int n,double x) ;

Return Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)
Read about return values of yn function .

1st Parameter Type : int

Integer type (typically 4 bytes, -2,147,483,648 to 2,147,483,647)

1st Parameter

The order of the Bessel function of the second kind to be computed.

2nd Parameter Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)

2nd Parameter

The input value for which the Bessel function of the second kind of order `n` is to be computed. Must be positive.

Read more about parameters of yn in parameters section
The ynfunction in C language Calculates the Bessel function of the second kind of order n for the given value.
yn computes the Bessel function of the second kind of order n for the input x. These special functions are solutions to Bessel's differential equation and are important in various areas of physics and engineering, particularly in problems involving cylindrical or spherical symmetry.
The ynfunction takes 2 parameters:
  • •
    int `n`: The order of the Bessel function of the second kind to be computed.
  • •
    double `x`: The input value for which the Bessel function of the second kind of order `n` is to be computed. Must be positive.
Computes the Bessel function of the second kind of order `n`, denoted as `Yn(x)`. Returns the computed value. If `x <= 0`, the behavior is undefined, and an error may be returned.
The yn function return value :
  • Returns the Bessel function of the second kind of order n for x
  • If x is negative, a domain error occurs and -HUGE_VAL is returned
  • If x is 0, a range error occurs and -HUGE_VAL is returned

Output

This example demonstrates the basic usage of yn to compute the Bessel function of the second kind of order 2 for x = 1.0.