Scroll Down to See All▾
abortabsacosasctimeasctime_rasinassertatanatan2atexitatofatoiatolbsearchbtowccalloccatclosecatgetscatopenceilclearerrclockcoscoshctimectime_rdifftimediverferfcexitexpfabsfclosefdopenfeofferrorfflushfgetcfgetposfgetsfgetwcfgetwsfopenfprintffputcfputwsfreadfreefreopenfrexpfscanffseekfsetposftellfwidefwprintffwritefwscanfgetcgetchargetenvgetwcgetwchargmtimegmtime_rhypotisalnumisalphaisasciiisblankiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalnumiswalphaiswblankiswcntrliswctypeiswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitisxdigitj0j1jnlabsldexpldivlocaleconvlocaltimelocaltime_rloglog10longjmpmallocmblenmbrlenmbrtowcmbsinitmbsrtowcsmbstowcsmbtowcmemchrmemcmpmemcpymemmovememsetmktimemodfnextafternextafterlnexttowardnexttowardlnl_langinfoperrorpowprintfputcputcharputenvputsputwcputwcharqsortquantexpd32quantexpd64quantexpd128quantized32quantized64quantized128samequantumd32raiserandrand_rreallocregcompregerrorregexecregfreeremoverenamerewindscanfsetbufsetjmpsetlocalesetvbufsignalsinsinhsnprintfsprintfsqrtsrandsscanfstrcasecmpstrcatstrchrstrcmpstrcollstrcpystrcspnstrerrorstrfmonstrftimestrlenstrncasecmpstrncatstrncmpstrncpystrpbrkstrptimestrrchrstrspnstrstrstrtodstrtod32strtod64strtod128strtofstrtokstrtok_rstrtolstrtoldstrtoulstrxfrmswprintfswscanfsystemtantanhtimetime64tmpfiletmpnamtoasciitolowertouppertowctranstowlowertowupperungetcungetwcva_argva_copyva_endva_startvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsprintfvsnprintfvsscanfvswprintfvswscanfvwprintfvwscanfwcrtombwcscatwcschrwcscmpwcscollwcscpywcscpywcsftimewcslenwcsncatwcsncmpwcsncpywcspbrkwcsptimewcsrchrwcsrtombswcsspnwcsstrwcstodwcstod32wcstod64wcstod128wcstofwcstokwcstolwcstoldwcstombswcstoulwcsxfrmwctobwctombwctranswctypewcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwprintfwscanfy1yn



Function Details : y0

doubley0(double x) ;

Return Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)
Read about return values of y0 function .

1st Parameter Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)

1st Parameter

The input value for which the Bessel function of the second kind of order 0 is to be computed. Must be positive.

Read more about parameters of y0 in parameters section
The y0function in C language Calculates the Bessel function of the second kind of order 0 for the given value.
y0 computes the Bessel function of the second kind of order 0 for the input x. These special functions are solutions to Bessel's differential equation and are important in various areas of physics and engineering, particularly in problems involving cylindrical or spherical symmetry.
The y0function takes 1 parameter:
  • •
    double `x`: The input value for which the Bessel function of the second kind of order 0 is to be computed. Must be positive.
Computes the Bessel function of the second kind of order 0, denoted as `Y0(x)`. Returns the computed value. If `x <= 0`, the behavior is undefined, and an error may be returned.
The y0 function return value :
  • Returns the Bessel function of the second kind of order 0 for x
  • If x is negative, a domain error occurs and -HUGE_VAL is returned
  • If x is 0, a range error occurs and -HUGE_VAL is returned

Output

This example demonstrates the basic usage of y0 to compute the Bessel function of the second kind of order 0 for x = 1.0.