Scroll Down to See All▾
abortabsacosasctimeasctime_rasinassertatanatan2atexitatofatoiatolbsearchbtowccalloccatclosecatgetscatopenceilclearerrclockcoscoshctimectime_rdifftimediverferfcexitexpfabsfclosefdopenfeofferrorfflushfgetcfgetposfgetsfgetwcfgetwsfopenfprintffputcfputwsfreadfreefreopenfrexpfscanffseekfsetposftellfwidefwprintffwritefwscanfgetcgetchargetenvgetwcgetwchargmtimegmtime_rhypotisalnumisalphaisasciiisblankiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalnumiswalphaiswblankiswcntrliswctypeiswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitisxdigitj0j1jnlabsldexpldivlocaleconvlocaltimelocaltime_rloglog10longjmpmallocmblenmbrlenmbrtowcmbsinitmbsrtowcsmbstowcsmbtowcmemchrmemcmpmemcpymemmovememsetmktimemodfnextafternextafterlnexttowardnexttowardlnl_langinfoperrorpowprintfputcputcharputenvputsputwcputwcharqsortquantexpd32quantexpd64quantexpd128quantized32quantized64quantized128samequantumd32raiserandrand_rreallocregcompregerrorregexecregfreeremoverenamerewindscanfsetbufsetjmpsetlocalesetvbufsignalsinsinhsnprintfsprintfsqrtsrandsscanfstrcasecmpstrcatstrchrstrcmpstrcollstrcpystrcspnstrerrorstrfmonstrftimestrlenstrncasecmpstrncatstrncmpstrncpystrpbrkstrptimestrrchrstrspnstrstrstrtodstrtod32strtod64strtod128strtofstrtokstrtok_rstrtolstrtoldstrtoulstrxfrmswprintfswscanfsystemtantanhtimetime64tmpfiletmpnamtoasciitolowertouppertowctranstowlowertowupperungetcungetwcva_argva_copyva_endva_startvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsprintfvsnprintfvsscanfvswprintfvswscanfvwprintfvwscanfwcrtombwcscatwcschrwcscmpwcscollwcscpywcscpywcsftimewcslenwcsncatwcsncmpwcsncpywcspbrkwcsptimewcsrchrwcsspnwcsstrwcstodwcstod32wcstod64wcstod128wcstofwcstokwcstolwcstoldwcstombswcstoulwcsxfrmwctobwctombwctranswctypewcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwprintfwscanfy0y1yn



Function Details : wcsrtombs

size_twcsrtombs(char * dest,const wchar_t ** src,size_t len,mbstate_t * ps) ;

Return Type : size_t

Platform-specific unsigned type for array indices and memory sizes.
Read about return values of wcsrtombs function .

1st Parameter Type : char *

String pointer (array of characters)

1st Parameter

Pointer to the destination buffer where the multibyte sequence will be stored.

2nd Parameter Type : const wchar_t **

Type const wchar_t ** parameters

2nd Parameter

Pointer to a pointer to the source wide-character string to be converted.

3rd Parameter Type : size_t

Platform-specific unsigned type for array indices and memory sizes.

3rd Parameter

Maximum number of bytes to write to `dest`.

4th Parameter Type : mbstate_t *

A pointer to an `mbstate_t` object that represents the current shift state for multibyte to wide character conversions. This pointer allows modification of the state during the conversion process.

4th Parameter

Pointer to a conversion state object used for multibyte conversions.

Read more about parameters of wcsrtombs in parameters section
The wcsrtombsfunction in C language Converts a sequence of wide characters from a wide character string to a multibyte string, considering the current locale.
wcsrtombs converts a sequence of wide characters from the array indirectly pointed to by src into a sequence of corresponding multibyte characters that begins in the initial shift state described by ps. If dst is not a null pointer, the converted characters are then stored into the array pointed to by dst. Conversion continues up to and including a terminating null wide character, which is also converted.
The wcsrtombsfunction takes 4 parameters:
  • •
    char * `dest`: Pointer to the destination buffer where the multibyte sequence will be stored.
  • •
    const wchar_t ** `src`: Pointer to a pointer to the source wide-character string to be converted.
  • •
    size_t `len`: Maximum number of bytes to write to `dest`.
  • •
    mbstate_t * `ps`: Pointer to a conversion state object used for multibyte conversions.
Converts a wide-character string to a multibyte string, using the state object `ps`. Returns the number of bytes written to `dest` or `(size_t)-1` if an error occurs.
The wcsrtombs function return value :
  • If dst is not NULL, returns the number of bytes in the resulting multibyte character sequence, not including the terminating null byte
  • If dst is NULL, returns the required size of the destination string
  • If an invalid wide character is encountered, (size_t)(-1) is returned and errno is set to EILSEQ

Output

This example demonstrates the basic usage of wcsrtombs to convert a wide character string to a multibyte string.