Scroll Down to See All▾
abortabsacosasctimeasctime_rasinassertatanatan2atexitatofatoiatolbsearchbtowccalloccatclosecatgetscatopenceilclearerrclockcoscoshctimectime_rdifftimediverferfcexitexpfabsfclosefdopenfeofferrorfflushfgetcfgetposfgetsfgetwcfgetwsfopenfprintffputcfputwsfreadfreefreopenfrexpfscanffseekfsetposftellfwidefwprintffwritefwscanfgetcgetchargetenvgetwcgetwchargmtimegmtime_rhypotisalnumisalphaisasciiisblankiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalnumiswalphaiswblankiswcntrliswctypeiswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitisxdigitj0j1jnlabsldexpldivlocaleconvlocaltimelocaltime_rloglog10longjmpmallocmblenmbrlenmbrtowcmbsinitmbsrtowcsmbstowcsmbtowcmemchrmemcmpmemcpymemmovememsetmktimemodfnextafternextafterlnexttowardnexttowardlnl_langinfoperrorpowprintfputcputcharputenvputsputwcputwcharqsortquantexpd32quantexpd64quantexpd128quantized32quantized64quantized128samequantumd32raiserandrand_rreallocregcompregerrorregexecregfreeremoverenamerewindscanfsetbufsetjmpsetlocalesetvbufsignalsinsinhsnprintfsprintfsqrtsrandsscanfstrcasecmpstrcatstrchrstrcmpstrcollstrcpystrcspnstrerrorstrfmonstrftimestrlenstrncasecmpstrncatstrncmpstrncpystrpbrkstrptimestrrchrstrspnstrstrstrtodstrtod32strtod64strtod128strtofstrtokstrtok_rstrtolstrtoldstrtoulstrxfrmswprintfswscanfsystemtantanhtimetime64tmpfiletmpnamtoasciitolowertouppertowctranstowlowertowupperungetcungetwcva_argva_copyva_endva_startvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsprintfvsnprintfvsscanfvswprintfvswscanfvwprintfvwscanfwcrtombwcscatwcschrwcscmpwcscollwcscpywcscpywcsftimewcslenwcsncatwcsncmpwcsncpywcspbrkwcsptimewcsrchrwcsrtombswcsspnwcsstrwcstodwcstod32wcstod64wcstod128wcstofwcstokwcstolwcstoldwcstombswcsxfrmwctobwctombwctranswctypewcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwprintfwscanfy0y1yn



Function Details : wcstoul

unsigned longwcstoul(const wchar_t * nptr,wchar_t ** endptr,int base) ;

Return Type : unsigned long

Large integer type (4 or 8 bytes, non-negative values)
Read about return values of wcstoul function .

1st Parameter Type : const wchar_t *

A pointer to a read-only wide-character string, where each character is of type `wchar_t`. Used for representing text in wide-character encoding to support extended character sets, such as Unicode. The string is null-terminated, with the terminator being a `wchar_t` with value 0.

1st Parameter

Pointer to the null-terminated wide-character string to be converted.

2nd Parameter Type : wchar_t **

Type wchar_t ** parameters

2nd Parameter

Pointer to a pointer to a wide character. It is set to the character in `nptr` where the conversion stopped.

3rd Parameter Type : int

Integer type (typically 4 bytes, -2,147,483,648 to 2,147,483,647)

3rd Parameter

The base of the number to be converted (e.g., 10 for decimal, 16 for hexadecimal). If 0, the base is automatically determined from the string format.

Read more about parameters of wcstoul in parameters section
The wcstoulfunction in C language Converts the initial portion of a wide character string to an unsigned long integer.
wcstoul converts the initial portion of the wide-character string pointed to by nptr to an unsigned long integer representation. It skips leading whitespace, recognizes an optional plus or minus sign, and converts the subsequent sequence of digits. The conversion is done according to the given base, which must be between 2 and 36 inclusive, or be the special value 0.
The wcstoulfunction takes 3 parameters:
  • •
    const wchar_t * `nptr`: Pointer to the null-terminated wide-character string to be converted.
  • •
    wchar_t ** `endptr`: Pointer to a pointer to a wide character. It is set to the character in `nptr` where the conversion stopped.
  • •
    int `base`: The base of the number to be converted (e.g., 10 for decimal, 16 for hexadecimal). If 0, the base is automatically determined from the string format.
Converts the initial part of the wide-character string `nptr` to an `unsigned long` integer value according to the given `base`. If `endptr` is not `NULL`, it points to the first character after the number that was converted.
The wcstoul function return value :
  • Returns the converted value, if any
  • If no conversion could be performed, 0 is returned
  • If the correct value is outside the range of representable values, ULONG_MAX is returned, and errno is set to ERANGE

Output

This example demonstrates the basic usage of wcstoul to convert a wide string to an unsigned long integer.