Scroll Down to See All
abortabsacosasctimeasctime_rasinassertatanatan2atexitatofatoiatolbsearchbtowccalloccatclosecatgetscatopenceilclearerrclockcoscoshctimectime_rdifftimediverferfcexitexpfabsfclosefdopenfeofferrorfflushfgetcfgetposfgetsfgetwcfgetwsfopenfprintffputcfputwsfreadfreefreopenfrexpfscanffseekfsetposftellfwidefwprintffwritefwscanfgetcgetchargetenvgetwcgetwchargmtimegmtime_rhypotisalnumisalphaisasciiisblankiscntrlisdigitisgraphislowerisprintispunctisspaceisupperiswalnumiswalphaiswblankiswcntrliswctypeiswdigitiswgraphiswloweriswprintiswpunctiswspaceiswupperiswxdigitisxdigitj0j1jnlabsldexpldivlocaleconvlocaltimelocaltime_rloglongjmpmallocmblenmbrlenmbrtowcmbsinitmbsrtowcsmbstowcsmbtowcmemchrmemcmpmemcpymemmovememsetmktimemodfnextafternextafterlnexttowardnexttowardlnl_langinfoperrorpowprintfputcputcharputenvputsputwcputwcharqsortquantexpd32quantexpd64quantexpd128quantized32quantized64quantized128samequantumd32raiserandrand_rreallocregcompregerrorregexecregfreeremoverenamerewindscanfsetbufsetjmpsetlocalesetvbufsignalsinsinhsnprintfsprintfsqrtsrandsscanfstrcasecmpstrcatstrchrstrcmpstrcollstrcpystrcspnstrerrorstrfmonstrftimestrlenstrncasecmpstrncatstrncmpstrncpystrpbrkstrptimestrrchrstrspnstrstrstrtodstrtod32strtod64strtod128strtofstrtokstrtok_rstrtolstrtoldstrtoulstrxfrmswprintfswscanfsystemtantanhtimetime64tmpfiletmpnamtoasciitolowertouppertowctranstowlowertowupperungetcungetwcva_argva_copyva_endva_startvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsprintfvsnprintfvsscanfvswprintfvswscanfvwprintfvwscanfwcrtombwcscatwcschrwcscmpwcscollwcscpywcscpywcsftimewcslenwcsncatwcsncmpwcsncpywcspbrkwcsptimewcsrchrwcsrtombswcsspnwcsstrwcstodwcstod32wcstod64wcstod128wcstofwcstokwcstolwcstoldwcstombswcstoulwcsxfrmwctobwctombwctranswctypewcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwprintfwscanfy0y1yn



Function Details : log10

doublelog10(double x) ;

Return Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)
Read about return values of log10 function .

1st Parameter Type : double

Double-precision floating point (±1.7E±308, ~15 decimal digits)

1st Parameter

The input value for which the base-10 logarithm is to be computed.

Read more about parameters of log10 in parameters section
The log10function in C language Calculates the base-10 logarithm of the specified number.
The log10 function computes the common (base-10) logarithm of x. If x is positive, the result is the base-10 logarithm of x. If x is zero or negative, a domain error occurs, and errno is set to EDOM.
The log10function takes 1 parameter:
  • double `x`: The input value for which the base-10 logarithm is to be computed.
Computes the base-10 logarithm of the given input `x`. The function is defined for positive values of `x` and returns `-HUGE_VAL` for values less than or equal to 0. Returns the base-10 logarithm as a `double`.
The log10 function return value :
  • Returns the base-10 logarithm of x
  • If x is positive infinity, positive infinity is returned
  • If x is 0, negative infinity is returned and errno is set to ERANGE
  • For negative x (including negative infinity), a domain error occurs, and errno is set to EDOM

Output

This example demonstrates basic usage of log10 function to compute the base-10 logarithm of 100.